DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Spaca3

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001346112.1 Gene:Spaca3 / 75622 MGIID:1922872 Length:163 Species:Mus musculus


Alignment Length:136 Identity:48/136 - (35%)
Similarity:74/136 - (54%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLGLG--LGLLLAIECGVVSAKRFLRCELARKLLD--QHGFERSLLSNWICLLEHESDLDTGRIT 71
            ||.|.  |..|||..    .||.|.|||||:::.|  ..|:....|::|:||..:.|..:|..:.
Mouse    19 WLALAYLLSCLLASS----KAKVFSRCELAKEMHDFGLDGYRGYNLADWVCLAYYTSGFNTNAVD 79

  Fly    72 TNANGSRNYGLFQING-RFCQEGRRGG--ICNAKCEDFLDENLRESVTCA-KRIQTSDGFRHWAG 132
            ..|:||.|.|:|||:. |:|:.....|  :|...|.|.|:.:|::|:.|| |.:|...|..:|..
Mouse    80 HEADGSTNNGIFQISSRRWCRTLASNGPNLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEA 144

  Fly   133 WQRYCR 138
            |:.:|:
Mouse   145 WRHHCQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 40/115 (35%)
Spaca3NP_001346112.1 LYZ1 36..159 CDD:238066 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.