DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Lyzl6

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 / 69444 MGIID:1916694 Length:148 Species:Mus musculus


Alignment Length:110 Identity:39/110 - (35%)
Similarity:62/110 - (56%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RCELARKLL--DQHGFERSLLSNWICLLEHESDLDTGRITTNANGSRNYGLFQINGRF-CQ--EG 93
            ||.||:.|.  |..|||...|.:|:||...||:.:..::..|.:||.:||:||||.|: |.  :.
Mouse    24 RCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVNENVDGSFDYGIFQINSRYWCNDYQS 88

  Fly    94 RRGGICNAKCEDFLDENLRESVTCAKRIQTS-DGFRHWAGWQRYC 137
            .....|:..|::.|..||..::.|||:|.:. .|.::|..|:.:|
Mouse    89 HSENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVEWKLHC 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 39/110 (35%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 39/110 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844159
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.