DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Lyc2

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001381322.1 Gene:Lyc2 / 688047 RGDID:1593616 Length:148 Species:Rattus norvegicus


Alignment Length:147 Identity:56/147 - (38%)
Similarity:80/147 - (54%) Gaps:11/147 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGLGLLLAIECGVVSAKRFLRCELARKLLDQ--HGFERSLLSNWICLLEHESDLDTGRITTNA-N 75
            |.||.||.  ...|.||.|..|||||.|...  .|:....|.||:|:.:|||:.||..|..|: :
  Rat     5 LVLGFLLL--SASVQAKVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEAINYNSTD 67

  Fly    76 GSRNYGLFQINGRF-CQEG---RRGGICNAKCEDFLDENLRESVTCAKR-IQTSDGFRHWAGWQR 135
            .|.:||:||||.|: |.:|   |....|...|...|.:::.:::.|||| ::...|.|.|..|||
  Rat    68 QSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSALLQDDITQAIQCAKRVVRDPQGIRAWVAWQR 132

  Fly   136 YCRNAQNLPNLKVICGI 152
            :|:| ::|......||:
  Rat   133 HCQN-RDLSGYIRNCGV 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 47/122 (39%)
Lyc2NP_001381322.1 LYZ1 19..147 CDD:197612 47/128 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.