DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and lyz

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_631919.1 Gene:lyz / 677744 ZFINID:ZDB-GENE-020515-2 Length:151 Species:Danio rerio


Alignment Length:114 Identity:40/114 - (35%)
Similarity:64/114 - (56%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AKRFLRCELARKLLDQ--HGFERSLLSNWICLLEHESDLDTGRITTNANGSRNYGLFQING-RFC 90
            :|...||::.:...::  .|||...:.|::|....||...|.|: .:|:..::||:||||. ::|
Zfish    18 SKTLGRCDVYKIFKNEGLDGFEGFSIGNYVCTAYWESRFKTHRV-RSADTGKDYGIFQINSFKWC 81

  Fly    91 QEGRRGG--ICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYC 137
            .:|..||  :|...|.|.|:::|:.||.|||.|...||.:.|..|..||
Zfish    82 DDGTPGGKNLCKVACSDLLNDDLKASVGCAKLIVKMDGLKSWETWDSYC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 40/113 (35%)
lyzNP_631919.1 LYZ1 19..140 CDD:238066 40/113 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589130
Domainoid 1 1.000 81 1.000 Domainoid score I8440
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5137
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - otm26024
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.