DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LYZL6

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001186880.1 Gene:LYZL6 / 57151 HGNCID:29614 Length:148 Species:Homo sapiens


Alignment Length:110 Identity:44/110 - (40%)
Similarity:66/110 - (60%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RCELAR--KLLDQHGFERSLLSNWICLLEHESDLDTGRITTNANGSRNYGLFQINGRF-CQEGR- 94
            ||:||:  :|.|..|||...||:|:||...||..:..:|..||:||.:|||||||..: |.:.: 
Human    24 RCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKS 88

  Fly    95 -RGGICNAKCEDFLDENLRESVTCAKRIQT-SDGFRHWAGWQRYC 137
             ...:|:..|:|.|:.||...:.|||||.: :.|..:|..|:.:|
Human    89 YSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHC 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 44/110 (40%)
LYZL6NP_001186880.1 LYZ1 22..142 CDD:238066 44/110 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153926
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.