DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and MGC89221

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001004951.1 Gene:MGC89221 / 448362 XenbaseID:XB-GENE-5851163 Length:140 Species:Xenopus tropicalis


Alignment Length:113 Identity:36/113 - (31%)
Similarity:56/113 - (49%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RCELARKLLDQH--GFERSLLSNWICLLEHESDLDTGRITTNANGS-RNYGLFQINGR-FCQEGR 94
            ||.:.|.:.:..  |.:...|.:::||....|     |..|:.|.| ..||:||||.. :|.:||
 Frog    22 RCSVVRAIRNGGVIGIKGYTLGDYVCLAYQAS-----RYDTSLNRSPTEYGIFQINSYWWCDDGR 81

  Fly    95 ---RGGICNAKCEDFLDENLRESVTCAKRI-QTSDGFRHWAGWQRYCR 138
               |..:|...|...|:.|:.:.|.|.:|| :..:|...|:.|.|||:
 Frog    82 TVGRKNLCGMSCRSLLNSNIGDDVRCLRRIVRDPNGLDAWSVWTRYCK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 36/113 (32%)
MGC89221NP_001004951.1 LYZ1 20..136 CDD:238066 36/113 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8219
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9321
Panther 1 1.100 - - O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.