DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LYZ

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_000230.1 Gene:LYZ / 4069 HGNCID:6740 Length:148 Species:Homo sapiens


Alignment Length:134 Identity:53/134 - (39%)
Similarity:76/134 - (56%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGLGLLLAIECGVVSAKRFLRCELAR--KLLDQHGFERSLLSNWICLLEHESDLDTGRITTNA-N 75
            ||| :||::   .|..|.|.||||||  |.|...|:....|:||:||.:.||..:|.....|| :
Human     7 LGL-VLLSV---TVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGD 67

  Fly    76 GSRNYGLFQINGRF-CQEGRRGG---ICNAKCEDFLDENLRESVTCAKR-IQTSDGFRHWAGWQR 135
            .|.:||:||||.|: |.:|:..|   .|:..|...|.:|:.::|.|||| ::...|.|.|..|:.
Human    68 RSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRN 132

  Fly   136 YCRN 139
            .|:|
Human   133 RCQN 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 47/118 (40%)
LYZNP_000230.1 LYZ1 19..147 CDD:197612 47/118 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.