DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and SPACA5

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001381227.1 Gene:SPACA5 / 389852 HGNCID:31353 Length:159 Species:Homo sapiens


Alignment Length:136 Identity:42/136 - (30%)
Similarity:74/136 - (54%) Gaps:9/136 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SWYWLGLGLGLLLAIECGVVSAKRFLRCELARKL--LDQHGFERSLLSNWICLLEHESDLDTGRI 70
            :|..:.:.|..|:.:   .|.||.:.|||||.:|  ...:|::...:.:|:|:..:||..||..:
Human     3 AWGTVVVTLATLMVV---TVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV 64

  Fly    71 TTNANGSRNYGLFQINGR-FCQEG--RRGGICNAKCEDFLDENLRESVTCAKRIQTS-DGFRHWA 131
            ..|.:||..||:||:|.. :|..|  ....:|:..|.|.|:.::.:.:.|||:|.:| :|...|.
Human    65 DHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWT 129

  Fly   132 GWQRYC 137
            .|:.:|
Human   130 SWRLHC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 37/114 (32%)
SPACA5NP_001381227.1 LYZ_C 22..147 CDD:340383 37/114 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154004
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 1 0.950 - 0 Normalized mean entropy S7264
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.