DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LysS

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_476829.1 Gene:LysS / 38130 FlyBaseID:FBgn0004430 Length:140 Species:Drosophila melanogaster


Alignment Length:124 Identity:46/124 - (37%)
Similarity:69/124 - (55%) Gaps:6/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRI-TTNANGSRNYG 81
            :||||....::.:...||.|||::.|. |..|..|..|.|:.:||||..|..: ..|::||.:||
  Fly     8 VLLAIAAPALAGRTLDRCSLAREMADL-GVPRDQLDKWTCIAQHESDYRTWVVGPANSDGSNDYG 71

  Fly    82 LFQINGRF-CQ-EGRRG-GICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYC 137
            :||||..: || :||.. ..|...|...|.:::..||.||:::.:..|:..||.| .||
  Fly    72 IFQINDLYWCQADGRFSYNECGLSCNALLTDDITNSVRCAQKVLSQQGWSAWAVW-HYC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 42/112 (38%)
LysSNP_476829.1 LYZ1 20..140 CDD:197612 42/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.