DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LysX

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_523881.1 Gene:LysX / 38122 FlyBaseID:FBgn0004431 Length:142 Species:Drosophila melanogaster


Alignment Length:133 Identity:46/133 - (34%)
Similarity:68/133 - (51%) Gaps:18/133 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGL-LLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRI-TTNANGSR 78
            ||: :||:....|..:...||.|||::.:. |..|..||.|.|:.||||...||.: ..|.:||.
  Fly     5 LGICVLALVTPAVLGRTMDRCSLAREMANM-GVSRDQLSKWACIAEHESSYRTGVVGPPNTDGSN 68

  Fly    79 NYGLFQIN---------GRFCQEGRRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQ 134
            :||:||||         |:|...|     |:..|...|.::::.||.||.::....|:..|:.| 
  Fly    69 DYGIFQINDMYWCQPSSGKFSHNG-----CDVSCNALLTDDIKSSVRCALKVLGQQGWSAWSTW- 127

  Fly   135 RYC 137
            .||
  Fly   128 HYC 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 41/118 (35%)
LysXNP_523881.1 lysozyme_like 20..140 CDD:294153 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458901
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
76.860

Return to query results.
Submit another query.