DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and CG11159

DIOPT Version :10

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_611505.1 Gene:CG11159 / 37341 FlyBaseID:FBgn0034539 Length:146 Species:Drosophila melanogaster


Alignment Length:143 Identity:64/143 - (44%)
Similarity:88/143 - (61%) Gaps:6/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PFGSWYWLGLGLGLLLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGR 69
            |.|...:|.|.|.||...|   ..:|...||:||::|| :|.|.||.||||:||:|.||...|.:
  Fly     6 PKGGALFLVLNLLLLSQWE---TESKLLTRCQLAKELL-RHDFPRSYLSNWVCLVEAESGRSTSK 66

  Fly    70 ITTNANGSRNYGLFQINGR-FCQEGRRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGW 133
            .....|.|.:|||||||.: :|::||||||||.|||:||::.:.:...||.:|....||:.|.||
  Fly    67 SMQLPNQSVSYGLFQINSKNWCRKGRRGGICNIKCEEFLNDEISDDSRCAMQIFNRHGFQAWPGW 131

  Fly   134 QRYCRNAQNLPNL 146
            ...|| .:.||::
  Fly   132 MSKCR-GRTLPDV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ_C_invert 30..147 CDD:381618 56/118 (47%)
CG11159NP_611505.1 LYZ_C_invert 28..146 CDD:381618 56/118 (47%)

Return to query results.
Submit another query.