DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and CG16799

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001286641.1 Gene:CG16799 / 37340 FlyBaseID:FBgn0034538 Length:179 Species:Drosophila melanogaster


Alignment Length:145 Identity:70/145 - (48%)
Similarity:107/145 - (73%) Gaps:6/145 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLGLGLGLLLAIECGV--VSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRITTN 73
            |:   :.:|:.::.|:  |.:|::.||||.|.|::.:.|:::.:||||||:||||.|||.::|..
  Fly    23 WI---VPVLILLQLGIEQVESKKYQRCELTRVLVENYNFDKTFISNWICLVEHESYLDTTKVTKK 84

  Fly    74 ANGSRNYGLFQINGR-FCQEGRRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYC 137
            .|.|:||||||||.: :|.|||:||.||.|||||.::::.:.:.||:.||..:||::|.||.|:|
  Fly    85 GNESKNYGLFQINSKDYCSEGRKGGQCNMKCEDFSNDDISDDIACARMIQEREGFKYWKGWDRFC 149

  Fly   138 RNAQNLPNLKVICGI 152
            ||.||||||:|.|.:
  Fly   150 RNPQNLPNLRVACNL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 61/115 (53%)
CG16799NP_001286641.1 LYZ1 41..162 CDD:238066 65/120 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468856
Domainoid 1 1.000 81 1.000 Domainoid score I8440
eggNOG 1 0.900 - - E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5137
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116778at33392
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - otm26024
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - P PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
1110.800

Return to query results.
Submit another query.