DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Lyzl6

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001129305.2 Gene:Lyzl6 / 287751 RGDID:1306968 Length:149 Species:Rattus norvegicus


Alignment Length:125 Identity:47/125 - (37%)
Similarity:68/125 - (54%) Gaps:10/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLAIECGVVSAKRFLRCELARKLL--DQHGFERSLLSNWICLLEHESDLDTGRITTNANGSRNYG 81
            ||.:..|.:    ..||.|||.|.  |..|||...|.:|:||...||..:..::|.||:|:.:||
  Rat    14 LLVVNDGSI----INRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNISKVTENADGTFDYG 74

  Fly    82 LFQINGRF-CQ--EGRRGGICNAKCEDFLDENLRESVTCAKRIQT-SDGFRHWAGWQRYC 137
            :||||.|: |.  :......|...||:.|:.||..|:.|||.|.: |.|.::|..|:.:|
  Rat    75 IFQINSRYWCNDYQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSGSGGMKNWVDWRLHC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 44/114 (39%)
Lyzl6NP_001129305.2 LYZ1 22..143 CDD:238066 44/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347523
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.