DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Spaca3

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 / 287557 RGDID:1306684 Length:163 Species:Rattus norvegicus


Alignment Length:136 Identity:50/136 - (36%)
Similarity:71/136 - (52%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 WLGLG--LGLLLAIECGVVSAKRFLRCELARKLLD--QHGFERSLLSNWICLLEHESDLDTGRIT 71
            ||.|.  |..|||..    .||.|.|||||:.|.|  ..|:....|::||||..:.|..:|..:.
  Rat    19 WLALAYLLSCLLASS----KAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAVD 79

  Fly    72 TNANGSRNYGLFQINGR-FCQEGRRGG--ICNAKCEDFLDENLRESVTCAKRI-QTSDGFRHWAG 132
            ..|:||.|.|:|||:.| :|:.....|  :|...|.|.|..:|::||.|..:| |...|..:|..
  Rat    80 HEADGSTNNGIFQISSRKWCKNLAPNGPNLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWES 144

  Fly   133 WQRYCR 138
            |:.:|:
  Rat   145 WKHHCQ 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 42/115 (37%)
Spaca3NP_001099290.1 LYZ_C 36..161 CDD:340383 42/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347599
Domainoid 1 1.000 89 1.000 Domainoid score I7645
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I4956
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.