DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Spaca5

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001078862.1 Gene:Spaca5 / 278203 MGIID:2685564 Length:160 Species:Mus musculus


Alignment Length:128 Identity:43/128 - (33%)
Similarity:70/128 - (54%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLAIECGVVSAKRFLRCELARKL----LDQHGFERSLLSNWICLLEHESDLDTGRITTNANGSR 78
            :|..:....:.||.:.|||||:||    ||  ||:...:.:|:|:..:||..||..:..|.:||.
Mouse    10 ILAVLLIAKLDAKIYERCELAKKLEEAGLD--GFKGYTVGDWLCVAHYESGFDTSFVDHNPDGSS 72

  Fly    79 NYGLFQINGR-FCQEG--RRGGICNAKCEDFLDENLRESVTCAKRIQTS-DGFRHWAGWQRYC 137
            .||:||:|.. :|..|  ....:||..|.|.|:.::.:.:.||||:.:| ...:.|..|.::|
Mouse    73 EYGIFQLNSAWWCNNGITPTQNLCNIDCNDLLNRHILDDIICAKRVASSHKSMKAWDSWTQHC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 41/116 (35%)
Spaca5NP_001078862.1 LYZ1 22..145 CDD:238066 41/116 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844238
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7264
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8674
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.