DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Lyz2

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_038934368.1 Gene:Lyz2 / 25211 RGDID:3026 Length:192 Species:Rattus norvegicus


Alignment Length:191 Identity:53/191 - (27%)
Similarity:79/191 - (41%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LGLGLLLAIECGVVSAKRFLRCELARKLL--DQHGFERSLLSNWICLLEHESDLDT-GRITTNAN 75
            |.||.||.  ...|.||.:.|||.||.|.  ...|:....|::|:||.:|||:.:| .|.....:
  Rat     5 LVLGFLLL--SASVQAKTYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQARNYNPGD 67

  Fly    76 GSRNYGLFQINGRF-CQEG---RRGGICNAKCE-------------------------------- 104
            .|.:||:||||.|: |.:|   |....|...|.                                
  Rat    68 QSTDYGIFQINSRYWCNDGKTPRAKNACGIPCSAVVTEKSSKHQQRRDILSLGTASIHLSGSLWE 132

  Fly   105 ------------DFLDENLRESVTCAKR-IQTSDGFRHWAGWQRYCRNAQNLPNLKVICGI 152
                        ..|.:::.:::.|||| ::...|.|.|..|||:|:| ::|......||:
  Rat   133 TLLRNVNPAVHTSLLQDDITQAIQCAKRVVRDPQGIRAWVAWQRHCKN-RDLSGYIRNCGV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 44/166 (27%)
Lyz2XP_038934368.1 LYZ1 19..191 CDD:197612 44/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8909
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.