DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and Lalba

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_034809.1 Gene:Lalba / 16770 MGIID:96742 Length:143 Species:Mus musculus


Alignment Length:126 Identity:40/126 - (31%)
Similarity:61/126 - (48%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LGLLLAIECGVVSAKRFLRCELARKLLDQHGFERSLLSNWICLLEHESDLDTGRITTNANGSRNY 80
            |.|:..:......|....:|:::..:.|..|::...|..|.|:|.|.|..|| :...|.|||..|
Mouse     7 LFLVCILSLPAFQATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDT-QAVVNDNGSTEY 70

  Fly    81 GLFQINGRF-CQEG---RRGGICNAKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYC 137
            |||||:.|| |:..   ....||...|:..||:.|.:.:.|||:|....|..:|..::..|
Mouse    71 GLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 37/112 (33%)
LalbaNP_034809.1 Lys 21..138 CDD:333808 37/112 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844229
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.