DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LYZL4

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 / 131375 HGNCID:28387 Length:146 Species:Homo sapiens


Alignment Length:117 Identity:42/117 - (35%)
Similarity:59/117 - (50%) Gaps:10/117 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RCELARKL----LDQHGFERSLLSNWICLLEHESDLDTGRITTNA-NGSRNYGLFQINGR-FCQE 92
            ||.:|:||    ||.  ||...|.||:||...||..:...|..|. .|...:||||:.|. :|.:
Human    24 RCTVAKKLHDGGLDY--FEGYSLENWVCLAYFESKFNPMAIYENTREGYTGFGLFQMRGSDWCGD 86

  Fly    93 GRRGGICNAKCEDFLDENLRESVTCAKRI-QTSDGFRHWAGWQRYCRNAQNL 143
            ..|.. |:..|...|:.||.:::.|||.| :..:|...|..|.|||:.:..|
Human    87 HGRNR-CHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPTWSRYCQYSDTL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 42/117 (36%)
LYZL4NP_001291315.1 LYZ_C 21..144 CDD:340383 42/117 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.