DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16756 and LYZL2

DIOPT Version :9

Sequence 1:NP_572222.2 Gene:CG16756 / 31460 FlyBaseID:FBgn0029765 Length:152 Species:Drosophila melanogaster
Sequence 2:XP_011517608.1 Gene:LYZL2 / 119180 HGNCID:29613 Length:181 Species:Homo sapiens


Alignment Length:111 Identity:40/111 - (36%)
Similarity:54/111 - (48%) Gaps:13/111 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GLLLAIECGVVSA--KRFLRCELA----RKLLDQH-GFERSLLSNWICLLEHESDLDTGRITTNA 74
            |:|..|.|.|..|  |.:.||:||    |..||.: ||.   |.||||:..:||..:|...|...
Human    51 GILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFS---LGNWICMAYYESGYNTTAQTVLD 112

  Fly    75 NGSRNYGLFQING-RFCQEG--RRGGICNAKCEDFLDENLRESVTC 117
            :||.:||:||||. .:|:.|  :....|:..|......|.....||
Human   113 DGSIDYGIFQINSFAWCRRGKLKENNHCHVACSGKAGRNTVRGETC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16756NP_572222.2 LYZ1 30..145 CDD:238066 34/96 (35%)
LYZL2XP_011517608.1 lysozyme_like 66..>145 CDD:294153 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153994
Domainoid 1 1.000 91 1.000 Domainoid score I7672
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I5068
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 1 1.000 - - FOG0000722
OrthoInspector 1 1.000 - - mtm8434
orthoMCL 1 0.900 - - OOG6_113391
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.