DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB1 and Sox102F

DIOPT Version :10

Sequence 1:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:40/73 - (54%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    96 KRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIA 160
            |||.:||.::..:.|.||....|.:...:::|.||..|...:..|||||.::.::|.:.:.:...
  Fly   424 KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHP 488

Human   161 AYRAKGKP 168
            .||.:.:|
  Fly   489 DYRYRPRP 496

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity