DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB1 and tHMG2

DIOPT Version :10

Sequence 1:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:72 Identity:16/72 - (22%)
Similarity:32/72 - (44%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   118 LLELVVTEDYWTPSLSAQASPVVTSGGYVTLQCESWPSYDRFILTVAGPQKFS----WTQDSQYN 178
            |::.::.|.:...::|....|...|  :..|:.|..||....::.:||.....    ||...:.|
  Fly    17 LVKTLLAEGHEVTTISRMPGPKHIS--WHELEKEGLPSGTTAVVNLAGQNVLDPTRRWTPGFKQN 79

Human   179 -YSTRKN 184
             :::|.|
  Fly    80 VWNSRIN 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108
HMG-box_HMGB_rpt2 93..163 CDD:438795 9/44 (20%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 7/29 (24%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 2/6 (33%)
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810 13/62 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.