DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB1 and CG12104

DIOPT Version :10

Sequence 1:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens
Sequence 2:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster


Alignment Length:116 Identity:27/116 - (23%)
Similarity:48/116 - (41%) Gaps:9/116 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    94 APKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKD 158
            ||.:|.:.|.||..:....||.::|..|:..:...:..||.:.....|..|..:..:.|.:|.:.
  Fly    75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139

Human   159 IAAYR-----AKGKPDAAKKGVVKAEKS----KKKKEEEEDEEDEEDEEEE 200
            :..||     ::|..:|.....|...:.    ..|.|..||.:...|.::|
  Fly   140 MRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQE 190

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 2/2 (100%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43