DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB1 and Sox14

DIOPT Version :10

Sequence 1:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:117 Identity:35/117 - (29%)
Similarity:56/117 - (47%) Gaps:5/117 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    80 PPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPY 144
            |....|:.|...|...|||.:||.::....|.||....|.|...:::|:||..|...:.||||||
  Fly   172 PYSDATRTKKHSPGHIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPY 236

Human   145 EKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEED 196
            ..:|.||::.:..:...|  |.:|   :|...::..|.|..::.:..|...|
  Fly   237 IIEAEKLRKLHMIEYPNY--KYRP---QKKQTRSPGSLKPNQDADGCEARND 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 4/16 (25%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 4/14 (29%)
LPS binding (Lipid A). /evidence=ECO:0000269|PubMed:21660935 80..96 4/15 (27%)
Cytokine-stimulating activity. /evidence=ECO:0000269|PubMed:12765338 89..108 6/18 (33%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 23/69 (33%)
Binding to AGER/RAGE. /evidence=ECO:0000250|UniProtKB:P63159 150..183 7/32 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..215 8/36 (22%)
Nuclear localization signal (NLS) 2. /evidence=ECO:0000250|UniProtKB:P63159 178..184 1/5 (20%)
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 26/79 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.