DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMGB1 and HmgZ

DIOPT Version :10

Sequence 1:NP_002119.1 Gene:HMGB1 / 3146 HGNCID:4983 Length:215 Species:Homo sapiens
Sequence 2:NP_726106.1 Gene:HmgZ / 37480 FlyBaseID:FBgn0010228 Length:111 Species:Drosophila melanogaster


Alignment Length:108 Identity:46/108 - (42%)
Similarity:65/108 - (60%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    95 PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDI 159
            ||||.||:.|:.:|.|.:||.::||..:.|:||:.||:|.  ...||..:|:||.|:||:|.|.:
  Fly     6 PKRPLSAYMLWLNETREQIKKDNPGSKVTDIAKRGGELWR--GLKDKTEWEQKAIKMKEEYNKAV 68

Human   160 AAYRAKGKPDAA-----KKGVVKAEKSKKKKEEEEDEEDEEDE 197
            ..|.|.|..|:.     ||...|..|..||||..|:||::|.|
  Fly    69 KEYEANGGTDSGAPKKRKKAAAKPAKKAKKKESSEEEEEDESE 111

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HMGB1NP_002119.1 Sufficient for interaction with HAVCR2. /evidence=ECO:0000250|UniProtKB:P63158 1..97 1/1 (100%)
LPS binding (delipidated). /evidence=ECO:0000269|PubMed:21660935 3..15
HMG-box_HMGB_rpt1 8..76 CDD:438794
Nuclear localization signal (NLS) 1. /evidence=ECO:0000250|UniProtKB:P63159 27..43
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..95 46/108 (43%)