DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spoon and vret

DIOPT Version :9

Sequence 1:NP_726992.2 Gene:spoon / 31459 FlyBaseID:FBgn0263987 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_651092.1 Gene:vret / 42695 FlyBaseID:FBgn0263143 Length:691 Species:Drosophila melanogaster


Alignment Length:318 Identity:57/318 - (17%)
Similarity:100/318 - (31%) Gaps:115/318 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 QEELEQDQEQTV--LKEEVVDSNGNQKRNVDAASPSLSICSVQSGDSGK----GSSLPRSEATRV 308
            :.|..||.....  :..|..|..||:..|                :||:    .:.||..:....
  Fly     2 ESESSQDDWSAFDPMSREYYDQVGNRYTN----------------ESGQKLIMEAPLPPKDEKEQ 50

  Fly   309 KTTYEFLFPI------------SLIGHLYGRKRAFINQIKAKTLASVSVGKNPYSGKVRICTIEG 361
            :.|.:..:|.            .::.:.:|  ||.|.:::.:.|:           :|.....|.
  Fly    51 RATRQAKYPYLVVPKSSPYVTEKMLINFFG--RALIKEMEFRRLS-----------RVYFVYFEN 102

  Fly   362 TESEIDAALAMIRQRLPAKRYPNFTMQRIHFALPQTIVPLSTESLYNLQLKLIEG-------INN 419
            .     |:|...:||:  :||||.                         :|.|.|       |.:
  Fly   103 I-----ASLETAQQRV--QRYPNL-------------------------IKCITGRPQKEREITS 135

  Fly   420 DVVVS---------AVLSGSHIFIQH----PL------HPSHPSLPLLQKQLYDSYSTMEA--PL 463
            |.|.|         |:.:.....:.|    |:      ||.....||:.|..|...|.:..  |:
  Fly   136 DPVTSTEPMPTPGPAISATERTPVNHNREVPISTGGQNHPEFFRPPLVTKDDYKRGSLLATNDPI 200

  Fly   464 LPSLELSAVCVIPINDVWYRVQIVDTDPEDEERCVIKFLDFGGYMNVGFNTLRQIRTD 521
            ...|.:.....:..:|: |::       :||.|.....|.|.....:..:|:.....|
  Fly   201 QRYLNVKYEFALERHDI-YKL-------KDETRIPQVVLHFRSGRTIPLSTVAVTEED 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoonNP_726992.2 KH-I 311..373 CDD:238053 11/73 (15%)
TUDOR 413..536 CDD:278965 27/137 (20%)
TUDOR 465..522 CDD:295375 10/57 (18%)
vretNP_651092.1 TUDOR 320..438 CDD:278965
TUDOR 374..419 CDD:119391
TUDOR 520..640 CDD:278965
TUDOR 577..622 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.