DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spoon and CG9925

DIOPT Version :9

Sequence 1:NP_726992.2 Gene:spoon / 31459 FlyBaseID:FBgn0263987 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_650324.1 Gene:CG9925 / 41702 FlyBaseID:FBgn0038191 Length:892 Species:Drosophila melanogaster


Alignment Length:386 Identity:78/386 - (20%)
Similarity:129/386 - (33%) Gaps:144/386 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SDEKDSPTTMLYGKSAPIKIQSNGRTSNGKHQQQIDSEILKSKIQDAEHKTLCSIDEDFENLSSP 179
            |:||   |.::.|....:..|..|.....:..|::|.:         .|:.:|.|   ...|...
  Fly     4 SEEK---TCVVCGTPTRLMCQRCGEPYCNEKCQKLDWQ---------RHRQVCII---MPPLVEC 53

  Fly   180 RDLPDSVNTRVSFYNRKATQKT--------VEPVVIKATRTPKISPEN----------------- 219
            |.|..::|...|..|:.|..||        |||.|....: |.:| ||                 
  Fly    54 RPLQPALNPIQSVENQVALAKTRTKSPIPCVEPTVAVPNK-PDLS-ENWRKHLLPSGMEFFKCRV 116

  Fly   220 SFLD-------TNYTNKE-----------CEQNNNCEPKEEPSKKEADQEELEQDQEQTVLKEEV 266
            :|::       .:..|.|           |.||          ||....|.:.:|   |::...|
  Fly   117 TFMENDGPIWVVHVANVEAIERMTVNMQRCMQN----------KKMIRMEGVRED---TLVAISV 168

  Fly   267 VDS--NGNQKRNVDAASPSLSICSVQSGDSGKGSSLPRSEATRVKTTYEFLFPISLIGHLYGRKR 329
            .|.  .|:          .|::|.            .:.||.           :.:|.|      
  Fly   169 GDKVHRGH----------VLTVCQ------------KKQEAN-----------VRMIDH------ 194

  Fly   330 AFINQIKAK------TLASVSVGKNPYSGKVRICTIEGTESEIDAALAMIRQRLPAKRYPNFTMQ 388
               .||.|.      |:.........::.:|::.|..|.:...:..|.|:..:.....|      
  Fly   195 ---GQIVATPFRDIYTIVPKMAESKAFAFRVQLPTNTGVQDIKNLTLRMLGTKTSDGAY------ 250

  Fly   389 RIHFALPQTIVPLSTESLYNLQLKLIEGINNDVVVSAVLSGSHIFIQHPLHPSHPSLPLLQ 449
            .:|.. |:.|:|||      |.|:::: :|.:|.|      ..:|..:|.| :.|.|.|||
  Fly   251 HVHLK-PKMIIPLS------LPLEMLQ-LNPEVKV------IRVFKANPKH-NEPQLALLQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoonNP_726992.2 KH-I 311..373 CDD:238053 10/67 (15%)
TUDOR 413..536 CDD:278965 11/37 (30%)
TUDOR 465..522 CDD:295375
CG9925NP_650324.1 zf-MYND 9..44 CDD:280009 6/43 (14%)
TUDOR 109..225 CDD:278965 25/170 (15%)
TUDOR 457..573 CDD:278965
TUDOR 718..843 CDD:278965
TUDOR 779..825 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.