DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spoon and CG15042

DIOPT Version :9

Sequence 1:NP_726992.2 Gene:spoon / 31459 FlyBaseID:FBgn0263987 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_573308.1 Gene:CG15042 / 32844 FlyBaseID:FBgn0030937 Length:436 Species:Drosophila melanogaster


Alignment Length:247 Identity:44/247 - (17%)
Similarity:78/247 - (31%) Gaps:114/247 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 LPAKRYPNFT-MQRIHFALPQTIVPLSTESL---------------YNLQLKLIEGINNDVVVSA 425
            :.|.:|.|.: |:|| ||||..:..|...::               .|::|:::.....:::|:.
  Fly   154 IDAAKYTNMSGMERI-FALPDDLKKLPALTIKCRLVNVAQMHIFITQNVRLRVLGSNGLELLVAL 217

  Fly   426 VLSGSHIFIQHPLHPSHPS--LPLLQKQLYDSYSTMEA--------------------------- 461
            :.:.::|       ...||  ||.:..   |.|..|:|                           
  Fly   218 IRNRTNI-------RKIPSAQLPPISG---DEYGNMDANDREVAKSFARYRPKRRERGSIVRVHV 272

  Fly   462 ----------------PLLPSLELSA------------VCVIPINDVWYRVQIVDTDPEDEERC- 497
                            |.:|:...|.            :.:.|....::|.:|||.     .|| 
  Fly   273 TRIVSHAEFYARFADGPTVPTWSKSVMKRGTGDFRVWDIVLAPYQGRYHRAKIVDI-----FRCR 332

  Fly   498 -VIKFLDFG------------------GYMNVGF-----NTLRQIRTDFMNV 525
             .:.|||||                  ...|:.|     .|.||....::|:
  Fly   333 YRVYFLDFGITEYTSKKNLTFCYELEKAQHNLAFRFEILGTRRQCPIPYINI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoonNP_726992.2 KH-I 311..373 CDD:238053
TUDOR 413..536 CDD:278965 31/195 (16%)
TUDOR 465..522 CDD:295375 19/93 (20%)
CG15042NP_573308.1 TUDOR 310..351 CDD:119391 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22948
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.