DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spoon and CG15930

DIOPT Version :9

Sequence 1:NP_726992.2 Gene:spoon / 31459 FlyBaseID:FBgn0263987 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_572214.2 Gene:CG15930 / 31446 FlyBaseID:FBgn0029754 Length:513 Species:Drosophila melanogaster


Alignment Length:425 Identity:79/425 - (18%)
Similarity:153/425 - (36%) Gaps:94/425 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 NKECEQNNN------C-EPKEEPSKKEADQEELEQDQEQTVLKEEVVDS----------NGNQKR 275
            ::|.|.||:      | ..|...:|..||..::.:..|...|:|:..||          ||..:.
  Fly    23 SEEAEDNNDVPLDLRCPSAKMRNNKVLADLSDMLKVVEDIALEEKTTDSKKPANSEQQINGTIEL 87

  Fly   276 NVDAASPSLSICSVQSGDSGKGSSLPRSE-ATRVKTT------------YEFLFPISLIGHLYGR 327
            .:|...|:..|..|.|..|.......::. |..:|||            :..:|...|...:...
  Fly    88 ALDLRQPNAKIRLVISDSSDLQKVFEKAHIALELKTTDSKPTAETDDQHHVRIFDKMLCNIVVPP 152

  Fly   328 KRAFINQIKAK----TLASVS-----------------------------VGKNPYSGKVRICTI 359
            ..|.: |:..|    .||:||                             |.:...|.:..:.:.
  Fly   153 DVADV-QVNGKPLEQLLATVSERQAMNNPGPMKMHELHTGNADFMNSNSQVAEAAASVETLLAST 216

  Fly   360 EGTESEIDAALA------MIRQRLPA-KRYPNF---TMQRIHFALPQTIVPLSTESLYNLQLKLI 414
            ...:|:.|...:      ::::.:|: ..:|:.   ::..:.:.||...|.:.    :.|..:.|
  Fly   217 SDNDSDSDGLESKTTDGYIVKELIPSFSDFPDIGDVSLCALMYGLPMDAVGMH----WKLPPQRI 277

  Fly   415 EGINND-----VVVSAVLSGSHIFIQHPLHPSHPSLPLLQKQL-------YDSYSTMEAPLLPS- 466
            :.|..:     :::|.|.|....:. |.:.|.:...|:.:..:       :.:.|:..|. ||| 
  Fly   278 QDICKEDSIFPIIMSCVFSPCEFWF-HIVPPQYAKNPVAEMTIDLNWFYRHTTISSYRAE-LPSY 340

  Fly   467 -LELSAVCVIPINDVWYRVQIVDTDPEDEERCVIKFLDFGGYMNVGFNTLRQIRTDFMNVPFQST 530
             .:...:|.......|.|..::.|.|.|.:...|:::|....:.:..|.||.:...|...|....
  Fly   341 FYKEGYICAAYSECGWRRAMVLVTAPLDAQCVNIEYVDHALSVTLAPNHLRFLPLSFARTPPLVF 405

  Fly   531 ECILSNIEPIGGTWSIEAAEILNKLTKGIVLQAQV 565
            ...:|::.|:...|.........::|...||.|.|
  Fly   406 RGKMSHVRPLANGWPKNGITAFQRMTFNRVLYAHV 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spoonNP_726992.2 KH-I 311..373 CDD:238053 14/112 (13%)
TUDOR 413..536 CDD:278965 26/136 (19%)
TUDOR 465..522 CDD:295375 13/58 (22%)
CG15930NP_572214.2 TUDOR 281..411 CDD:278965 24/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.