DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and Ggnbp1

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_081820.2 Gene:Ggnbp1 / 70772 MGIID:3055306 Length:370 Species:Mus musculus


Alignment Length:526 Identity:97/526 - (18%)
Similarity:155/526 - (29%) Gaps:236/526 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 RKNLLECVELVK--------KLAQKPPTSTVTPSTPTISYIEEKLKAALEHLTPIVPMTG--GSF 218
            |..:|.|..:::        |...|.....:|.|.|:.|:.::          .:.||.|  |..
Mouse     9 RSRILGCSSMLRFLRNLVGSKGGSKSTNKPLTRSQPSSSWEQD----------VVSPMMGHQGGR 63

  Fly   219 DDSSSRGSLAAAGGGGGVGSSRNRQVAIPMPPPEPSSGLSTSDSLTSVPGMAKRIDQYSATTNGN 283
            .....|..:.:|....|     .|:     |||...|...::          .|.|.:...| |:
Mouse    64 GRKEPRAKVHSAASSNG-----KRE-----PPPRVLSAAPSN----------PRHDAFELGT-GD 107

  Fly   284 TGNKRLLTLETPRIENERLPRVRGLTNLGNTCFFNAVMQCLAQTPF--LLSVLKELSEPGEEFIL 346
            :|::.|.:.:.|::      |.:|:.              :...|.  ...||::|.|       
Mouse   108 SGSQTLTSKDVPKL------RAQGVE--------------VTSVPLRGTWEVLEQLPE------- 145

  Fly   347 PGGTFTIKDKGDIELPMIKGTLSSWGGLTAA-----LANALEELQAGGSVFTPRKLFDRLCVKCP 406
                    .||:.|.|:        |.::.|     ...|||..|.                 |.
Mouse   146 --------KKGEEEEPV--------GEVSGASDREHFGQALETEQG-----------------CL 177

  Fly   407 QFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDR 471
            |:..|.                         :.|....:       :.||..:.|.|   :.|| 
Mouse   178 QWVPGP-------------------------LALTPGAF-------IKEEEDEHCPI---EFGD- 206

  Fly   472 ILRPEQVFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV---AVEKPQPPQRRKPSPELSL----- 528
             |:|              ..|...|:...|.|.:...:   |:.|.|.|    .:|:|:|     
Mouse   207 -LKP--------------SSCKVGSTPWNYLLGLYKQLQKSAMAKAQRP----AAPQLALKDGLP 252

  Fly   529 ---------------------TSSSSSVTP-------STGQPTINTKF--TDGSVNFTASSPSFF 563
                                 .:||....|       ||.|..:..||  ||             
Mouse   253 HEEKGEREEAVDESCPKWCAPRASSDESCPKWCAPRASTYQSPLQKKFRSTD------------- 304

  Fly   564 LHAHEAASLGPSKSQVKKEKERQRKAKRAAKKRQKSSLNLNGNDSGNGNELAESVDQDDASLASL 628
                   ::|..:|::||....||:|:          |...||..|.     |.:.|.|.:|...
Mouse   305 -------TVGFVESELKKILSVQREAR----------LWKVGNPEGR-----ELLTQPDITLEEA 347

  Fly   629 GAGDGQ 634
            |..|||
Mouse   348 GMVDGQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592 33/214 (15%)
Peptidase_C19K <849..1123 CDD:239132
Ggnbp1NP_081820.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..114 23/118 (19%)
Required for induction of mitochondrial fragmentation 225..370 36/168 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..263 4/26 (15%)
Ubiquitin_3 281..368 CDD:291502 27/108 (25%)
Interaction with GGN 298..370 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5560
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.