DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and usp45

DIOPT Version :10

Sequence 1:NP_572220.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_001362196.1 Gene:usp45 / 496571 XenbaseID:XB-GENE-5800887 Length:806 Species:Xenopus tropicalis


Alignment Length:33 Identity:7/33 - (21%)
Similarity:12/33 - (36%) Gaps:12/33 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IPFVYSAFTVAWGFVKMDDELVIFCNPPISLHP 163
            :|..|:||.            .:..:.|..:||
 Frog   173 LPVPYAAFP------------PLISSDPFLIHP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_572220.1 zf-UBP 108..159 CDD:460464 4/27 (15%)
UBP12 <307..990 CDD:227847
Peptidase_C19 307..>512 CDD:470612
Peptidase_C19K <849..1123 CDD:239132
usp45NP_001362196.1 zf-UBP 81..134 CDD:460464
UBP12 <177..806 CDD:227847 6/29 (21%)
Peptidase_C19 194..>390 CDD:470612 7/33 (21%)
Peptidase_C19K <609..803 CDD:239132
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.