DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and Ggnbp1

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:XP_006256187.1 Gene:Ggnbp1 / 494520 RGDID:1359729 Length:377 Species:Rattus norvegicus


Alignment Length:462 Identity:102/462 - (22%)
Similarity:149/462 - (32%) Gaps:165/462 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SSSRGSLAAAGGGGGVGSSRNRQVAIPMPPPEPSSGLSTSDSLTSVPGMAKRIDQYSATTNGNTG 285
            ||....|.:..|..|...|.||    |:...:|||  |....:.| |.|..:         |..|
  Rat    16 SSMLRFLRSLVGSKGSSKSSNR----PLNRSQPSS--SPEQDVVS-PTMGHQ---------GGCG 64

  Fly   286 NK----RLLTLET--------PRI-----ENERLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSV 333
            .|    |:|:..:        ||:     .|:||....|| ..|:|.         :||.....|
  Rat    65 RKETRPRVLSATSSNGKREPRPRVLSAAPSNQRLRDASGL-GTGDTG---------SQTLTSKDV 119

  Fly   334 LKELSEPGEEFILP-GGTFTI-----KDKGDIELPM--IKGTLSSWGGLTAALANALEELQAGGS 390
            ||..::..|...:| .||:.:     :.||:...|.  :.|...|: |:.|....|||..|.   
  Rat   120 LKLRAQGVEVTSVPTRGTWEVLEHLPEKKGEEGEPAGEVSGASDSF-GIRAHFGQALEAEQG--- 180

  Fly   391 VFTPRKLFDRLCVKCPQFTGGDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSE 455
                          |.|:..|.                         ::|....:       :.|
  Rat   181 --------------CLQWVSGP-------------------------MVLPPEAF-------IKE 199

  Fly   456 EMRQKCKIYGNQAGDRILRPEQVFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPV---AVEKPQPP 517
            |..:.|.|   ..||                |....|...|:...|.|.:...:   |:.|.|.|
  Rat   200 EEDEHCLI---DFGD----------------LRLSSCKVGSTPWNYLLGLYKQLQKSAMTKAQRP 245

  Fly   518 QRRKPSPELSLTSSS--------------SSV---TPSTGQPTINTKFTDGSVNFTASSP---SF 562
            .  ..:|:.:|..||              ||:   .|.......|.|:. ...|.|..||   :|
  Rat   246 D--ADAPQFALKDSSPTEERGEREEAVDESSLKWCAPRASSDDSNLKWC-APRNSTYQSPLQKTF 307

  Fly   563 FLHAHEAASLGPSKSQVKKEKERQRKAKRAAKKRQKSSLNLNGNDSGNGNELAESVDQDDASLAS 627
                ....::|..:|::||....||:|:          |...||..|.     |.:.|.|.:|..
  Rat   308 ----RSTDTVGFVESELKKILAVQREAR----------LWKVGNPEGR-----ELLTQPDITLEE 353

  Fly   628 LGAGDGQ 634
            .|..|||
  Rat   354 AGMVDGQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592 40/215 (19%)
Peptidase_C19K <849..1123 CDD:239132
Ggnbp1XP_006256187.1 Ubiquitin_3 289..375 CDD:291502 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5560
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.