DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and Usp20-33

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_610943.2 Gene:Usp20-33 / 36580 FlyBaseID:FBgn0033916 Length:975 Species:Drosophila melanogaster


Alignment Length:482 Identity:97/482 - (20%)
Similarity:157/482 - (32%) Gaps:150/482 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 VEDNLVEDTA-APSTNNVPS-STASLTAPSKTYMDSNGNAQP-----PGEKRDDTPEHMDKDSLE 721
            :.:.|.|..: .|.|.|.|. .:.....||:|..:::..|.|     ..|...||.|    .|:.
  Fly   188 LHEELTEQVSMLPQTQNQPQYQSLQQQQPSETDDENDDEAAPASLSHASESEYDTCE----SSMS 248

  Fly   722 EDENDSGIATS--PAPTATNSSTSTSATGNNNSVAGSGL----SGSSGALEDPL-APASLVTAGL 779
            |...:..:.|.  ..|..||.|.|....|::..:..:.|    ..:|.|.:.|: |..|:::...
  Fly   249 ERSAEVLLKTEYFVTPCRTNGSNSGLPEGHSVQLQQAPLQHQQKNASSAEQKPIEAARSIISDVF 313

  Fly   780 SEKGASVIR-----QVSVGAE--QGASNGTEDADGEAKAIEQPEKTPSQAQAMAQAQARTKRVRT 837
            ..|..|.::     :||...|  |..|....:.| ....:.|......|:...|:..|||    .
  Fly   314 DGKLLSSVQCLTCDRVSTREETFQDLSLPIPNRD-FLNVLHQTHSLSVQSLNAAETSART----N 373

  Fly   838 QSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNA 902
            :.:..|...:. |........::..|:.:|.:.:.:.|.|...|:.|.:...|            
  Fly   374 EGWLSWMWNML-RSWIYGPSVTLYDCMASFFSADELKGDNMYSCERCNKLRTG------------ 425

  Fly   903 TKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKKLL 967
            .|...|.:.|.||.:|||||: .......|::..|.:|  |:     |..::...:.|.|.:..:
  Fly   426 IKYSRVLTLPEVLCIHLKRFR-NDLSYSSKISSDVYFP--LE-----GFDMRPYIHKDCKSEVAI 482

  Fly   968 YALYGVVEHSGGMYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQLKKLEELLAKEKA 1032
            |.|..|:.|.|.:.|||||.                                             
  Fly   483 YNLSSVICHHGTVGGGHYTC--------------------------------------------- 502

  Fly  1033 REQHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQPQQLEEAANVRAPPGKWY 1097
                         |:.::.|                                         ||||
  Fly   503 -------------FARNTLN-----------------------------------------GKWY 513

  Fly  1098 YVSDSRVQEVSEDTALKAQAYLLFYER 1124
            ...|..|.|||.:.....|||:|||.:
  Fly   514 EFDDQFVTEVSSELVQSCQAYVLFYHK 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592
Peptidase_C19K <849..1123 CDD:239132 51/273 (19%)
Usp20-33NP_610943.2 UCH 79..538 CDD:278850 95/478 (20%)
Peptidase_C19 80..>204 CDD:271592 4/15 (27%)
Peptidase_C19R 307..538 CDD:239139 66/355 (19%)
DUSP 560..643 CDD:197831
DUSP 667..755 CDD:197831
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5560
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.