DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and DUBAI

DIOPT Version :10

Sequence 1:NP_572220.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_610784.1 Gene:DUBAI / 36361 FlyBaseID:FBgn0033738 Length:852 Species:Drosophila melanogaster


Alignment Length:114 Identity:22/114 - (19%)
Similarity:39/114 - (34%) Gaps:29/114 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 YRRIENT----TYTAMMLFIPFVYSAFTVAWGFVKMDDELVIFCNPPISLHPVVSRWWSMSNVAL 176
            |.|:.||    .|...||.:|.:..:   ....|.:.....|...|.:..       :::|.:|:
  Fly   103 YDRVMNTNIRAVYHLTMLAVPHLLQS---QGNVVNVSSVNGIRSFPGVLA-------YNISKMAV 157

  Fly   177 NSITLCLFLFL---------------IITFHFRGKKQKSDTRKLMKRLK 210
            :..|.|:.|.|               :...|.||...:....|.::..|
  Fly   158 DQFTRCVALELAAKGVRVNCVNPGVTVTNLHKRGGMDEQTYAKFLEHSK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_572220.1 zf-UBP 108..159 CDD:460464 11/46 (24%)
UBP12 <307..990 CDD:227847
Peptidase_C19 307..>512 CDD:470612
Peptidase_C19K <849..1123 CDD:239132
DUBAINP_610784.1 Peptidase_C19H 359..739 CDD:239129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.