DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and Usp14

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_001260321.1 Gene:Usp14 / 34387 FlyBaseID:FBgn0032216 Length:475 Species:Drosophila melanogaster


Alignment Length:355 Identity:81/355 - (22%)
Similarity:137/355 - (38%) Gaps:98/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 RLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSVLKELSEPGEEFILPGGTFTIKDKGDIELPMIK 365
            |||  .|||||||||:.||.:|||...|.|.:.|...|..|.:                      
  Fly   101 RLP--AGLTNLGNTCYMNATVQCLNAVPELRTALSTFSNDGTD---------------------- 141

  Fly   366 GTLSSWGGLTAALANALEELQAGGSVFTPRKLFDRLCVKCPQF--TGGD----QHDAHELLRQLL 424
             |:|:...:::|:.:...:::.|.:| ||..|...|....|||  ||.:    |.||:|...::|
  Fly   142 -TMSTAFSISSAMKSIFAQMEKGTTV-TPIVLLQALHRASPQFAQTGENGTYRQQDANECWAEIL 204

  Fly   425 ESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFRG-FLVSTLT 488
                        :::.|.|..|:|:.::..:: |....|            :|.|.| |.|...:
  Fly   205 ------------KMLQQKLRPKNQEPSNTVQK-RHSSFI------------DQFFGGTFEVKMSS 244

  Fly   489 CQDCHNVSS-RHEYFLDMSLPVAVEKPQPPQRRKPSPELSLTSSSSSV--------------TPS 538
            .:|....|: ..|.||.:|..::::........|...:..|...|.::              .|:
  Fly   245 EEDPDEPSTVTSENFLQLSCFISMDVKYMQSGLKSKMKEQLVKKSETLGRDAKYIRTYLVSRLPA 309

  Fly   539 -----------TGQPTINTKFTDGSVNFTASSPSFFLHAHEAAS-LGPSKSQVKKEKERQRK--- 588
                       .|:..||.|... .:.|.....:|.|...|..: |.|.:|:.|..::::.:   
  Fly   310 YLTVQFVRFQYKGKEGINAKVLK-DIKFPIDFDAFELCTPELQNKLCPMRSKFKDLEDKKMEVDV 373

  Fly   589 AKRAAKKRQKSSL---------NLNGNDSG 609
            .||.....:|..:         :|..|:||
  Fly   374 VKRNEPNEEKKDVKYEQFWFDDDLGSNNSG 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592 55/212 (26%)
Peptidase_C19K <849..1123 CDD:239132
Usp14NP_001260321.1 UBQ 4..73 CDD:214563
UBQ 5..73 CDD:294102
UCH 103..467 CDD:278850 79/353 (22%)
Peptidase_C19A 105..467 CDD:239122 78/349 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456923
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.