DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and Usp7

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_572779.2 Gene:Usp7 / 32169 FlyBaseID:FBgn0030366 Length:1129 Species:Drosophila melanogaster


Alignment Length:201 Identity:53/201 - (26%)
Similarity:81/201 - (40%) Gaps:52/201 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 SVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQ 923
            ::.....::.|.|.:.|.||....     ::|..        .|:|.::.:|.|.||.|||.|||
  Fly   386 NIYESFQDYVAPETLEGDNKYDAG-----VHGLQ--------EASKGVIFTSFPPVLHLHLMRFQ 437

  Fly   924 LGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDR---KQKKLL--YALYGVVEHSGGMYGG 983
            ..|     .....:.|.:..:.....        |:||   :.:..|  |.|:.|:.|||..:||
  Fly   438 YDP-----VTDSSIKYNDRFEFYEHI--------NLDRYLAESENTLADYVLHAVLVHSGDNHGG 489

  Fly   984 HYTAYVKVRPKVAPGDKRW-KFLPHGSKAELDQDDDQLKKLEELLAKEKAREQHLKVLDDSDDFS 1047
            ||..:  :.||   .|.|| ||           |||.:....    |::|.||:...:||...|.
  Fly   490 HYVVF--INPK---ADGRWFKF-----------DDDVVSSCR----KQEAIEQNYGGMDDEISFH 534

  Fly  1048 NSSSNS 1053
            ...||:
  Fly   535 AKCSNA 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592
Peptidase_C19K <849..1123 CDD:239132 53/201 (26%)
Usp7NP_572779.2 MATH_HAUSP 100..229 CDD:239741
COG5077 101..1119 CDD:227409 53/201 (26%)
peptidase_C19C 239..549 CDD:239124 53/201 (26%)
USP7_ICP0_bdg 647..886 CDD:289221
USP7_C2 897..1113 CDD:291217
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24006
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.