Sequence 1: | NP_001284890.1 | Gene: | Usp16-45 / 31458 | FlyBaseID: | FBgn0029763 | Length: | 1126 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_572779.2 | Gene: | Usp7 / 32169 | FlyBaseID: | FBgn0030366 | Length: | 1129 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 53/201 - (26%) |
---|---|---|---|
Similarity: | 81/201 - (40%) | Gaps: | 52/201 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 859 SVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQ 923
Fly 924 LGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDR---KQKKLL--YALYGVVEHSGGMYGG 983
Fly 984 HYTAYVKVRPKVAPGDKRW-KFLPHGSKAELDQDDDQLKKLEELLAKEKAREQHLKVLDDSDDFS 1047
Fly 1048 NSSSNS 1053 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Usp16-45 | NP_001284890.1 | zf-UBP | 108..159 | CDD:280334 | |
Peptidase_C19 | 307..>512 | CDD:271592 | |||
Peptidase_C19K | <849..1123 | CDD:239132 | 53/201 (26%) | ||
Usp7 | NP_572779.2 | MATH_HAUSP | 100..229 | CDD:239741 | |
COG5077 | 101..1119 | CDD:227409 | 53/201 (26%) | ||
peptidase_C19C | 239..549 | CDD:239124 | 53/201 (26%) | ||
USP7_ICP0_bdg | 647..886 | CDD:289221 | |||
USP7_C2 | 897..1113 | CDD:291217 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45456930 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24006 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |