DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Usp16-45 and usp-33

DIOPT Version :9

Sequence 1:NP_001284890.1 Gene:Usp16-45 / 31458 FlyBaseID:FBgn0029763 Length:1126 Species:Drosophila melanogaster
Sequence 2:NP_510570.2 Gene:usp-33 / 181647 WormBaseID:WBGene00010702 Length:716 Species:Caenorhabditis elegans


Alignment Length:347 Identity:84/347 - (24%)
Similarity:124/347 - (35%) Gaps:83/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 IDQYSATTNGNTGNKRLLTLETPRIENERLPRVRGLTNLGNTCFFNAVMQCLAQ-TPFLLSVLKE 336
            :.::...|..:|.:|  :..||.::|......:.|..|.||||:.|||:|.|.. :||...::  
 Worm   151 VKRFLTHTKFSTSDK--VEQETRKMEPLAFRGLLGYLNFGNTCYMNAVLQLLGHCSPFTQYLI-- 211

  Fly   337 LSEPGEEFILPGGTFTIKDKGDIELPMIKGTLSSWGGLTAALANALEELQAGGSVFTPRKLFDRL 401
                  |.|.|||......  ||....|:..|.        |.|...:...  ...:|.|:.  .
 Worm   212 ------ELIPPGGWSNCSH--DIPKTAIQMALD--------LRNMYSDFPL--PYLSPWKII--T 256

  Fly   402 CVK--CPQFTGGDQHDAHELLRQLLESVRNEDLK---RYQRV-ILQNLGYKDQDVNSVSEEMRQK 460
            ||:  .|.|....|.||.|.:|.||: :.:.|||   .|.|. .|..:|..:.|..........|
 Worm   257 CVRNEMPGFECFQQQDASEFMRNLLD-ILDRDLKTCSEYHRTNTLIEMGNPEMDYAIAMNAPHTK 320

  Fly   461 CKIYGNQAGDRILRPEQVFRGFLVSTLTCQDCHNVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPE 525
            ..|            ..:|:|.|.:.:.|..|...|...|.|||:|:|:..|....         
 Worm   321 TAI------------SAIFQGVLENQIQCHSCGFRSRTIENFLDLSIPIVGENEFE--------- 364

  Fly   526 LSLTSSSSSVTPSTGQPTINTKFTDGSVNFTASSPSFFLH--AHEAASL---------------- 572
             .:.:|....||..  |..::...||      ..|.|.:|  |....||                
 Worm   365 -EMYASKKLDTPKA--PCTSSNIEDG------QDPGFLVHQGAFNKTSLESCLDRFFQNSTLQDD 420

  Fly   573 ---GPSKSQVKKEKERQRKAKR 591
               ..||.:|..:..:..||.|
 Worm   421 NQYSCSKCEVLVDATKSTKAHR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Usp16-45NP_001284890.1 zf-UBP 108..159 CDD:280334
Peptidase_C19 307..>512 CDD:271592 59/211 (28%)
Peptidase_C19K <849..1123 CDD:239132
usp-33NP_510570.2 Peptidase_C19 183..546 CDD:239072 78/313 (25%)
UCH 183..545 CDD:278850 78/313 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5560
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.