DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NAAT1 and CG31904

DIOPT Version :9

Sequence 1:NP_572219.1 Gene:NAAT1 / 31457 FlyBaseID:FBgn0029762 Length:641 Species:Drosophila melanogaster
Sequence 2:NP_723310.1 Gene:CG31904 / 319016 FlyBaseID:FBgn0260479 Length:403 Species:Drosophila melanogaster


Alignment Length:408 Identity:76/408 - (18%)
Similarity:123/408 - (30%) Gaps:130/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SSNGSGNGATNAASTE------------KTDAEKPTAERT--------NWGNGLEF-LMSCISVS 55
            :.:|.|.|.:.|.:..            :|.:...|.||.        .|....:| ..||....
  Fly    38 TESGGGMGGSLALAARRIRSRQVHSMAVRTGSAYDTLERPYRHDKCRGRWAKSADFYFASCTHAF 102

  Fly    56 VGLGNVWRFPFTAYENGGGAFLIPYIIVLFLIGKPMYYLEMIMGQFTSQGTVKIWSVVPGFVGVG 120
            ..|.......|.....|...|:|.|::.:.....|::.::..:|||:|.||:..:.|.|.|.|:|
  Fly   103 SSLIFSELSTFGILHGGWLLFIIAYLMGMLFYSLPIFLIQAFLGQFSSSGTISAFRVAPIFKGIG 167

  Fly   121 YGQAFGTICIISYYSSLLALTLYYLFVSFQSELPWSYCRDEWTNCVNSRPQEYVDNLLTGVSLAN 185
            |......:..::|||....:.|.|...|....:||..|.:.|..                     
  Fly   168 YAILLLNLGTLTYYSIAAVVPLIYTVNSIHPVIPWMSCNNSWNT--------------------- 211

  Fly   186 ESARNLSGIVANDETEKLQSSSELYFLNVVIKEKLDISDGVGDPDWKLTLALFVAWVVIFLVIMR 250
                              |..|        :.|..|:.              |...|:..|.:..
  Fly   212 ------------------QECS--------LHENYDVD--------------FAVAVIFTLALAM 236

  Fly   251 GVKSS---------GKAAYFLALF-PYVVLFVLLIRAVTLEGARDGILFFLEPQWGELLNPTVWK 305
            ||:||         |....:.|:. |.||.....:.|.               .|...:|...|.
  Fly   237 GVQSSVIPLLSQVAGHGLSYTAVSGPAVVASPWAVPAA---------------HWPAAVNVASWP 286

  Fly   306 EAVVQCFF---------SLAVGSGPIIMFASYNRFDHGIYRDAMIVTTLDTLTSLLGGITIFAIL 361
            .|.:....         ::.....|.::.|....  .|:|       |..|    .|.|....:.
  Fly   287 PAAIHAAAPAVLAAPAPAVVAAHAPSVVVAPVAH--SGVY-------TAQT----RGAIHTAPLA 338

  Fly   362 GNLAHNLQIENIRDVVRS 379
            |::.|..: ...|::|||
  Fly   339 GHILHQCR-SRTRNLVRS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NAAT1NP_572219.1 SLC6sbd 40..533 CDD:271359 68/360 (19%)
CG31904NP_723310.1 SLC5-6-like_sbd 123..>243 CDD:294310 37/180 (21%)
Cuticle_4 276..344 CDD:292577 13/80 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0733
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11616
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.