DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment XRCC1 and Xndc1

DIOPT Version :9

Sequence 1:NP_572217.1 Gene:XRCC1 / 31451 FlyBaseID:FBgn0026751 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_001316819.1 Gene:Xndc1 / 102549471 RGDID:7692537 Length:407 Species:Rattus norvegicus


Alignment Length:352 Identity:91/352 - (25%)
Similarity:144/352 - (40%) Gaps:56/352 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSEDAVHVAANLLKENAGKKWRTKAPGEKSAYVVLEF--EEPQQITGIDIGNEHAAFIEVLVSRT 75
            ||:|..:...|||..::.|......|.:|:..:.:||  |....|:.||:||...||:::.|.|:
  Rat    13 SSQDPKYPVENLLNPDSHKGPWLSCPRDKTGQLKVEFQLERAVPISYIDVGNCGCAFLQIDVGRS 77

  Fly    76 GCQAD-DFRELLLSSSFMTPIESKNSSNPNRVRCFSSTSLAESALPEKWKLLQIVCTQPFNRHVP 139
            ....| .|..||.::..|:..:||...|.:.||.|........|..|.|..|::.|:|||.||..
  Rat    78 SWPLDRPFVTLLPATMLMSLTDSKEGKNRSGVRMFKDDDFLIPASGESWDRLRLTCSQPFTRHQS 142

  Fly   140 YGLSFVKVH-VVAAAAPKVKSLVPQGVMQFGTFKLREESPDSETDNQVNRFHSWKKQTQHKSPAI 203
            :||:|::|. .:.:.:..||.               ..||.|...||    :|..|.....||.:
  Rat   143 FGLAFLRVRSSLDSLSDPVKD---------------PSSPGSSGLNQ----NSSDKLESDPSPWL 188

  Fly   204 SATSTAAAIRDAGSTALRRLSA--GKVSSLAASPKTSTSPSPVLNALRSVSPTPLDAKPLDRNRA 266
            :..|..........|:.:.:||  |.:..|        .|.|:..|.|.|......|.|     |
  Rat   189 TNPSIRRTFFPDPQTSTKEISALKGMLKQL--------QPGPLGRAARMVLSAAHKAPP-----A 240

  Fly   267 SLLFGDDDEDVKDAEVNAKKQRLSKHLEADKDRRRLEQEKERESRKKKSSRHSLDKSISKEDKPP 331
            |::..::.....|          |.|.|      |.|...|..:||..:||....|  .:|.:.|
  Rat   241 SVVSPNNSHGEPD----------SSHPE------RAEPRAEEPNRKNNASRGKRRK--VQEQRRP 287

  Fly   332 AKEHNSSSREKSTAKEEKEQLRKEERS 358
            ....:|....::|.:.::.|.|.:.:|
  Rat   288 LSSSSSQPNRRATGRTKQRQQRPQAKS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
XRCC1NP_572217.1 XRCC1_N 1..144 CDD:280080 44/133 (33%)
BRCT 420..494 CDD:278934
Xndc1NP_001316819.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D248725at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.