DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HMBS and l(3)02640

DIOPT Version :9

Sequence 1:NP_000181.2 Gene:HMBS / 3145 HGNCID:4982 Length:361 Species:Homo sapiens
Sequence 2:NP_612103.1 Gene:l(3)02640 / 46140 FlyBaseID:FBgn0010786 Length:652 Species:Drosophila melanogaster


Alignment Length:330 Identity:166/330 - (50%)
Similarity:210/330 - (63%) Gaps:24/330 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    15 SPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTK 79
            |.:.:|||||:|||:||.|||..|:..|:..||..:|||..|||.||::|:.:|.|||||||||:
  Fly     2 SAQEKVIRVGSRKSELALIQTKHVIGRLQKLYPKQKFEIHTMSTFGDRVLNVSLPKIGEKSLFTR 66

Human    80 ELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVG 144
            :||.||....||.||||||||||.||.|..|||:.:||:..||:|....|.|.|:.:||:.||:|
  Fly    67 DLEDALRNGGVDFVVHSLKDLPTALPTGMAIGAVLEREDARDALVLRENFKGHTIASLPKGSVIG 131

Human   145 TSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLD-EQQEFSAIILATAGLQRMGWHNRVGQILHP 208
            ||||||.||::|.:|||....|||||||||.||| ...:||.||||.|||.||||.:|:.|:|.|
  Fly   132 TSSLRRTAQIRRMYPHLTVCDIRGNLNTRLAKLDAADSKFSGIILAQAGLVRMGWMSRISQVLEP 196

Human   209 EECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMK- 272
            .:.:||||||||.||.||.|..:|.::..|....|..|.:|||:||:.|.||||.||||.:.:| 
  Fly   197 TDLLYAVGQGALAVECRANDDQVLAMLQKLMCLNTTCRILAERSFLKTLGGGCSAPVAVWSNLKG 261

Human   273 ---DGQ-----LYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQL 329
               :|.     |.|||.||||||:..|:..:..     |.:|...|.|.:         .||.|.
  Fly   262 EPLNGNSQEVGLSLTGAVWSLDGAIEIRNHLAC-----ALNEQKLEGDQR---------KRGAQE 312

Human   330 AAQNL 334
            |...|
  Fly   313 ATSQL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HMBSNP_000181.2 PBP2_HuPBGD_like 20..299 CDD:270363 156/288 (54%)
l(3)02640NP_612103.1 hemC 6..289 CDD:234612 155/282 (55%)
PBP2_HuPBGD_like 7..296 CDD:270363 156/293 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154595
Domainoid 1 1.000 240 1.000 Domainoid score I2274
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H158
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189095at2759
OrthoFinder 1 1.000 - - FOG0004130
OrthoInspector 1 1.000 - - oto89973
orthoMCL 1 0.900 - - OOG6_101048
Panther 1 1.100 - - LDO PTHR11557
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R556
SonicParanoid 1 1.000 - - X2873
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.