DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm3 and MCM7

DIOPT Version :9

Sequence 1:NP_511048.2 Gene:Mcm3 / 31449 FlyBaseID:FBgn0284442 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_005907.3 Gene:MCM7 / 4176 HGNCID:6950 Length:719 Species:Homo sapiens


Alignment Length:705 Identity:234/705 - (33%)
Similarity:359/705 - (50%) Gaps:129/705 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GEQFIKDIQRE----YVDFLDDEEDQ---------------GIYAGHVKDMIAEKSKRLIVNVND 50
            |.|.::...||    |||..|..||.               .::|..|::::.:..:|.:||   
Human    34 GNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVN--- 95

  Fly    51 LKRKNPQRALGLLSNAADEQLAFGRALKEYASTVDPGYAKMHEDLF---------VGFEGCFGNR 106
                         .:..|..:.. |.:.|..|. |||..:..::.:         :.|:|...|:
Human    96 -------------KDVLDVYIEH-RLMMEQRSR-DPGMVRSPQNQYPAELMRRFELYFQGPSSNK 145

  Fly   107 HVTPRSLTSIYLGNMVCVEGIVTKVSLIRPKVVRSVHYCPNTRKVMERKYTDLTSFEAVPSGAAY 171
            ....|.:.:..:|.:|.|.||||:||.::||:|.:.:.|..         ....:::.:.|....
Human   146 PRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQ---------CGAETYQPIQSPTFM 201

  Fly   172 P----------TKDEDGNLLETEYGLSVYKDHQTLTIQEMPEKAPAGQLPRSVDIVCDDDLVDRC 226
            |          |....|.|.....| |.:...|.:.:||..::.|.|.:|||:.::.:.:.....
Human   202 PLIMCPSQECQTNRSGGRLYLQTRG-SRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIA 265

  Fly   227 KPGDRVQIVGSYRCLPGKRGGY---TSGTF-RTVLLANNISLLSK----ESNL-DISREDIMLCK 282
            :|||.|.:.|.:  ||..|.|:   ..|.. .|.|.|:.|..::|    ||.. :::||::   :
Human   266 QPGDHVSVTGIF--LPILRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREEL---R 325

  Fly   283 KLAKNNDIFELLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLLIGDPSVAKS 347
            ::|: .|.:|.|:.|:||.|:||..||:|:|.||:|||:: .|.|.::||:||:.|:|||.||||
Human   326 QIAE-EDFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDQ-SPRGMKIRGNINICLMGDPGVAKS 388

  Fly   348 QLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDI 412
            |||.|:...|||:..|||||||||||||||..|..:||..||.||:||||:||.||||||||::.
Human   389 QLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLRDSVSGELTLEGGALVLADQGVCCIDEFDKMAEA 453

  Fly   413 DRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLL 477
            |||||||||||..::|:||||..:||||||:||||||.||||:..::..:||.|..:||||||||
Human   454 DRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLL 518

  Fly   478 FVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYD 542
            :::.|..|.|.|..::.|:..:|::.....:..|||.|                           
Human   519 WLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDM--------------------------- 556

  Fly   543 ALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPI 607
                             :.||:||.:.:..:|.:.|...:.|...|..:|.:.....|...|   
Human   557 -----------------KLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYT--- 601

  Fly   608 TARTLETLIRLSTAHARARMSKSVTIDDAHAAIELVQFAYFKKVLDKDRPSKRRR 662
            :||||..::|||||.||.||...|..:|.:.||.|::.:....:.||.:.::.:|
Human   602 SARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQR 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm3NP_511048.2 MCM_N 18..101 CDD:379644 17/106 (16%)
MCM 106..648 CDD:214631 206/560 (37%)
MCM7NP_005907.3 MCM_N 10..93 CDD:405270 13/58 (22%)
MCM 145..641 CDD:214631 206/559 (37%)
Arginine finger 513..516 2/2 (100%)
Interaction with RAD17. /evidence=ECO:0000269|PubMed:15538388 521..564 13/86 (15%)
Interaction with ATRIP 577..719 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232729at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.