DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm3 and mei-218

DIOPT Version :9

Sequence 1:NP_511048.2 Gene:Mcm3 / 31449 FlyBaseID:FBgn0284442 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001027068.1 Gene:mei-218 / 3772646 FlyBaseID:FBgn0002709 Length:1186 Species:Drosophila melanogaster


Alignment Length:386 Identity:70/386 - (18%)
Similarity:120/386 - (31%) Gaps:117/386 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 APSIHGHAYVKQAILC--------------------------------------------LLLGG 319
            |||.||..|.|..:.|                                            :||..
  Fly   804 APSQHGQEYPKPDLNCVPSSIKKLHHLISSQYSDYSFVYALSAQISQDCVPMDCFVYLKMILLAS 868

  Fly   320 VEKILPNGTRLRGDINVLLIGDPSVAKSQLLRYVLNTAPRAIPTTGRGSSGVGLTAAVTTDQETG 384
            :..|  ....:|..|::.:|...|:..::||..|...|||.:     |....||...... ..|.
  Fly   869 IVSI--ESDEVRAPISLCIIATDSLMANRLLNKVGQLAPRFL-----GPHEYGLQPTFNA-LPTR 925

  Fly   385 ERRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHASLNARCSVLAAANP 449
            ...:.|..::||.:||....:::::|......:.:.:|.|.|.:.:..|...|.|....      
  Fly   926 FNWIVASPLLLAQQGVYYAGDWNRLSKDQGCQLEKCIENGAVPVPQLHIDQPLKAAVWT------ 984

  Fly   450 VYGRYDQYKTPMENIGLQDSLLSRFDLLFVMLDVIDSDVDQMISDHVVRMHRYRNPKEADGEPLS 514
                   |..| .|...|...|::...:|                               |.|:.
  Fly   985 -------YWQP-NNSTNQTLALAKLCPIF-------------------------------GLPIY 1010

  Fly   515 MGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHEKILSVEFMRKYIHIAKCMKPKLGEQ 579
            ||:..::||.          ..:.:|::|  .|:........:..:.||..||:....|..|.:.
  Fly  1011 MGAQASNSLW----------NSIIQKHNA--EGQIVVNDGLSIPEDDMRMLIHLLHQRKTTLTDG 1063

  Fly   580 ACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLSTAHARARMSKSVTIDDAHAAI 640
            |...:...|...|.:        |....:::|...|.:|:...|:..:...|...|...||
  Fly  1064 AQHMLQKYYVISRKE--------RPNVFSSKTYIVLKQLAECFAKLALRLEVLESDVCVAI 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm3NP_511048.2 MCM_N 18..101 CDD:379644
MCM 106..648 CDD:214631 70/386 (18%)
mei-218NP_001027068.1 PTZ00112 122..>417 CDD:240274
MCM <1023..1116 CDD:278895 19/102 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11630
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.