DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mcm3 and MCMDC2

DIOPT Version :9

Sequence 1:NP_511048.2 Gene:Mcm3 / 31449 FlyBaseID:FBgn0284442 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_775789.3 Gene:MCMDC2 / 157777 HGNCID:26368 Length:681 Species:Homo sapiens


Alignment Length:480 Identity:99/480 - (20%)
Similarity:166/480 - (34%) Gaps:136/480 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 RSVDIVCDDDLVDRCKPGDRVQIVGSYRCLPGKRGGYTSGTFRTVLLANNISLLSKESNLDISRE 276
            :|:.|...|:.|::...|:..:|:|...|:.      ||.| ...:.||:|:..:.:....||  
Human   229 QSLTIFLRDESVNKMNIGNEYKIIGIPTCVK------TSQT-AVCIEANSITFCNSKVPSGIS-- 284

  Fly   277 DIMLCKKLAKNNDIFE---LLSKSLAPSIHGHAYVKQAILCLLLGGVEKILPNGTRLRGDINVLL 338
            |...|.....::..::   :|:...|..|..........||||:..|:....| ..|...:::|:
Human   285 DNFRCLLSLTSSSCWKFTAILANIFASQITPPGTYNLLKLCLLMSLVQTTDRN-KELEDCLDILI 348

  Fly   339 IGDPSVAKSQLLRYVLNTAPRAI---------PTTGRGSSGVGLTAAVTTDQETGERRLEAGAMV 394
            |...::...:||.:.:|..||.|         ||..|...|            ||...::||:.:
Human   349 ITSDTLLIDRLLNFSINLVPRGIRHLVSTEIFPTLSRNKYG------------TGAVSIQAGSAL 401

  Fly   395 LADRGVVCIDEF-----DKMSDIDRTAIHEVMEQGRVTISKAG--------IHASLNARCSVLA- 445
            ||..|:..|.:.     ||:..     :..|:|...:|:...|        ...:...:||..: 
Human   402 LAKGGICFIGDLASHKKDKLEQ-----LQTVLESRSITVYIPGKKFGEDIDQQMTFPVQCSFWSF 461

  Fly   446 ------------AANPVYGRYDQYKTPMENIGLQDSLLSRFDLLF---------VMLDVIDSDVD 489
                        ..|.:.|:.|....|.       :|:..|.||.         ..|..:...::
Human   462 VDVDSSSRRNAQKINTLIGQMDCSLIPA-------NLVEAFGLLINCNESSPCHPFLPTVQHTLN 519

  Fly   490 QMISDHVVRMHRYRNPKEADGEPLSMGSSYADSLSFVSSSEEKKDTEVYEKYDALLHGKSRQRHE 554
            :.|           ||:         |..||.|..|.        ||.:||..|.         .
Human   520 KAI-----------NPE---------GLFYAASRQFT--------TEDFEKLLAF---------A 547

  Fly   555 KILSVEFMRKYIHIAKCMKPKLGEQACEAIANEYSRLRSQEAVETDVARTQPITARTLETLIRLS 619
            |.|:|||                  :.||....:....:...:.|.......::|..|:.|:.||
Human   548 KNLNVEF------------------SLEAERMTHGYYLASRRIRTGSVCGSKLSASALKYLVFLS 594

  Fly   620 TAHARARMSKSVTIDDAHAAIELVQ 644
            .||||..:...|..:|...|..|.:
Human   595 EAHARLNLRNKVLKEDVLIAALLFE 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mcm3NP_511048.2 MCM_N 18..101 CDD:379644
MCM 106..648 CDD:214631 99/480 (21%)
MCMDC2NP_775789.3 PTZ00111 <358..>435 CDD:173403 22/93 (24%)
MCM <514..622 CDD:278895 34/161 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1241
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.