DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnp4F and RBM23

DIOPT Version :9

Sequence 1:NP_001096883.3 Gene:Rnp4F / 31448 FlyBaseID:FBgn0014024 Length:941 Species:Drosophila melanogaster
Sequence 2:XP_024305408.1 Gene:RBM23 / 55147 HGNCID:20155 Length:515 Species:Homo sapiens


Alignment Length:203 Identity:49/203 - (24%)
Similarity:83/203 - (40%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   627 KPRSRIKP-----NSQSAYP-RQQKLKPRQQQQQTNREPLNREQRRR-QAHEQQQQQQQQQKHGI 684
            :.|||.:.     ||:|..| ||.:.:.|...::...|..:|:.||. :.|.:........::|.
Human   119 RSRSRDRDRYRRRNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGH 183

  Fly   685 KKSRTEPSGGATSPPSKVKGPANAEAKESNFKYSP-NMEINKIFVRNLHPACSKEELHELFSPFG 748
            .|          ||..:.|.|    .:|.....|| ..:...:|...|.......:|.:.||..|
Human   184 SK----------SPHFREKSP----VREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFFSAVG 234

  Fly   749 TIKDVRLVHKLN-KQFKGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAISNPPPRGTS-AVKP 811
            .::|||::...| ::.||||||||               |..:.:.:::.::.....|.. .|:.
Human   235 KVRDVRIISDRNSRRSKGIAYVEF---------------CEIQSVPLAIGLTGQRLLGVPIIVQA 284

  Fly   812 SVAPKRRV 819
            |.|.|.|:
Human   285 SQAEKNRL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnp4FNP_001096883.3 RRM <681..>811 CDD:223796 30/132 (23%)
RRM_SF 722..802 CDD:302621 19/80 (24%)
Paf1 <816..922 CDD:281915 2/4 (50%)
Lsm_interact 922..940 CDD:283133
RBM23XP_024305408.1 RRM 143..514 CDD:330708 40/179 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.