Sequence 1: | NP_001096883.3 | Gene: | Rnp4F / 31448 | FlyBaseID: | FBgn0014024 | Length: | 941 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024305408.1 | Gene: | RBM23 / 55147 | HGNCID: | 20155 | Length: | 515 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 49/203 - (24%) |
---|---|---|---|
Similarity: | 83/203 - (40%) | Gaps: | 39/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 627 KPRSRIKP-----NSQSAYP-RQQKLKPRQQQQQTNREPLNREQRRR-QAHEQQQQQQQQQKHGI 684
Fly 685 KKSRTEPSGGATSPPSKVKGPANAEAKESNFKYSP-NMEINKIFVRNLHPACSKEELHELFSPFG 748
Fly 749 TIKDVRLVHKLN-KQFKGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAISNPPPRGTS-AVKP 811
Fly 812 SVAPKRRV 819 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rnp4F | NP_001096883.3 | RRM | <681..>811 | CDD:223796 | 30/132 (23%) |
RRM_SF | 722..802 | CDD:302621 | 19/80 (24%) | ||
Paf1 | <816..922 | CDD:281915 | 2/4 (50%) | ||
Lsm_interact | 922..940 | CDD:283133 | |||
RBM23 | XP_024305408.1 | RRM | 143..514 | CDD:330708 | 40/179 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3656 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |