DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnp4F and rnp24

DIOPT Version :9

Sequence 1:NP_001096883.3 Gene:Rnp4F / 31448 FlyBaseID:FBgn0014024 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_594970.1 Gene:rnp24 / 2542965 PomBaseID:SPAC3G6.04 Length:369 Species:Schizosaccharomyces pombe


Alignment Length:234 Identity:56/234 - (23%)
Similarity:98/234 - (41%) Gaps:41/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   643 QQKLKPRQQQQQTN-REPLNREQR------------RRQAHEQQQQQQQQQKHG---IKKSRTEP 691
            ::.:||...:|.|. ..|:::|:|            ...|.:...|..::..:|   :.||.|:.
pombe   138 EENIKPITTEQITRIHMPMSKEKRFQNKGFAYVDFATEDALKLALQCSEKALNGRNILIKSNTDF 202

  Fly   692 SGGATSPPSKVKGPANAEAKESNFKYSPNMEINKIFVRNLHPACSKEELHELFSPFGTIKDVRLV 756
            ||    .|||   |||..:|.::.:.|.....:.:||.||....:..:|.|.|...|.|:.|||:
pombe   203 SG----RPSK---PANTLSKTASIQSSKKEPSSILFVGNLDFETTDADLKEHFGQVGQIRRVRLM 260

  Fly   757 -HKLNKQFKGIAYVEFEKPGEAQRAV-AGRDGC-LFKGMNISVAISNPPPRGTSA---------- 808
             .:...:.||..:|:|.......:|: .|.:.. |..|.:.|..:.|..|...|.          
pombe   261 TFEDTGKCKGFGFVDFPDIDTCMKAMELGHNSWRLEYGEDRSKRMRNKSPMARSGRFNDAESLGQ 325

  Fly   809 -VKPSVAPKRRV-PTSLIPTTLVRQEVAAKKLRLLLPEP 845
             .||:....|:: |.|:.|...:.:   |::....:.||
pombe   326 EDKPNFKRARKIDPRSVRPGAALAK---AQRSSAAIVEP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnp4FNP_001096883.3 RRM <681..>811 CDD:223796 38/146 (26%)
RRM_SF 722..802 CDD:302621 22/82 (27%)
Paf1 <816..922 CDD:281915 7/31 (23%)
Lsm_interact 922..940 CDD:283133
rnp24NP_594970.1 RRM 9..308 CDD:223796 44/176 (25%)
RRM1_Nop13p_fungi 107..199 CDD:240842 11/60 (18%)
RRM2_Nop13p_fungi 230..299 CDD:240843 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3656
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.