DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rnp4F and Srsf7

DIOPT Version :9

Sequence 1:NP_001096883.3 Gene:Rnp4F / 31448 FlyBaseID:FBgn0014024 Length:941 Species:Drosophila melanogaster
Sequence 2:NP_666195.1 Gene:Srsf7 / 225027 MGIID:1926232 Length:238 Species:Mus musculus


Alignment Length:94 Identity:33/94 - (35%)
Similarity:48/94 - (51%) Gaps:7/94 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 KIFVRNLHPACSKEELHELFSPFGTIKDVRLVHKLNKQFKGIAYVEFEKPGEAQRAVAGRDGCLF 789
            |::|.||.....|.||...||.:|.::.|.:.    :...|.|:||||.|.:|:.||.|.||.:.
Mouse    12 KVYVGNLGTGAGKGELERAFSYYGPLRTVWIA----RNPPGFAFVEFEDPRDAEDAVRGLDGKVI 72

  Fly   790 KGMNISVAISNPPPRGTSAVKPSVAPKRR 818
            .|..:.|.:|...||.:...:|   |.||
Mouse    73 CGSRVRVELSTGMPRRSRFDRP---PARR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rnp4FNP_001096883.3 RRM <681..>811 CDD:223796 29/85 (34%)
RRM_SF 722..802 CDD:302621 27/76 (36%)
Paf1 <816..922 CDD:281915 2/3 (67%)
Lsm_interact 922..940 CDD:283133
Srsf7NP_666195.1 RRM_SRSF7 12..88 CDD:410050 28/79 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12545
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.