Sequence 1: | NP_001096883.3 | Gene: | Rnp4F / 31448 | FlyBaseID: | FBgn0014024 | Length: | 941 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001273554.1 | Gene: | RNPS1 / 10921 | HGNCID: | 10080 | Length: | 305 | Species: | Homo sapiens |
Alignment Length: | 261 | Identity: | 58/261 - (22%) |
---|---|---|---|
Similarity: | 98/261 - (37%) | Gaps: | 74/261 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 626 VKPRS--RIKPNSQSAYPR-----------QQKLKPRQQQQQTNREPLNREQRRRQAHEQQQQQQ 677
Fly 678 QQQKHGIKKSRTEPSGGATS--------------------------------------------- 697
Fly 698 -PPSKVKGPANAEAKESNFKYSPNMEINKIFVRNLHPACSKEELHELFSPFGTIKDVRL-VHKLN 760
Fly 761 KQF-KGIAYVEFEKPGEAQRAVAGRDGCLFKGMNISVAI-----SNPPPRGTSAVKPSVAPKRRV 819
Fly 820 P 820 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |