DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas10 and AT3G28230

DIOPT Version :9

Sequence 1:NP_572215.1 Gene:Sas10 / 31447 FlyBaseID:FBgn0029755 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001118727.1 Gene:AT3G28230 / 822449 AraportID:AT3G28230 Length:174 Species:Arabidopsis thaliana


Alignment Length:159 Identity:49/159 - (30%)
Similarity:79/159 - (49%) Gaps:29/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 QLEALLERIEDGDAFTVLDVAQRKAKLQILNKYNDGQQASVSSDDDDNDDDDDAESKEKDLQEEA 346
            :|.|.||.....:..|||    :.||.|...|            .:|::|:...:.|:|...::|
plant    31 KLRAALEGKHRSNGSTVL----KSAKAQKRQK------------SEDSEDEFYRQVKQKQEAKKA 79

  Fly   347 GEEE-------------EEEDARRGITYQMAKNKGLTPHRKKELRNPRVKHRGKYRKALIRRKGA 398
            .:.|             :..|.||.|:.|||.|:|||..|.|:.:|||.|:|.:::|.:|.|||.
plant    80 AKAEIYSRKPYLIPSSPDLVDGRRLISNQMASNRGLTRKRNKDHKNPRKKYRDQHKKIVINRKGQ 144

  Fly   399 VRTVRKELQRYGGELSGIKAGVTKSVKFR 427
            ||.:|.::..|.||..||....::|::.:
plant   145 VRDIRTQVGPYAGETRGINPYTSRSIRIK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sas10NP_572215.1 Sas10_Utp3 191..269 CDD:281929
Sas10 354..426 CDD:286457 32/71 (45%)
AT3G28230NP_001118727.1 Sas10 99..172 CDD:286457 32/72 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3363
eggNOG 1 0.900 - - E1_KOG3118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451774at2759
OrthoFinder 1 1.000 - - FOG0004426
OrthoInspector 1 1.000 - - otm2649
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.