DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas10 and CG11030

DIOPT Version :9

Sequence 1:NP_572215.1 Gene:Sas10 / 31447 FlyBaseID:FBgn0029755 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001260103.1 Gene:CG11030 / 33805 FlyBaseID:FBgn0031736 Length:332 Species:Drosophila melanogaster


Alignment Length:289 Identity:65/289 - (22%)
Similarity:119/289 - (41%) Gaps:69/289 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PEFIILTQDFQQHLDEVKNLLKPVLNYVRKHDVPMVPALQYAGLCHTVLTTYCSNVAFYLLLKAR 248
            |:.|.|..:...::.:|.:|::.:|..|::.::.....|.:..:.:.:|..|..|:.:.:|.|..
  Fly    17 PQAIQLLGEMNSNVKQVTDLVEGMLQRVKRGELTTEYGLSFLEVKYHMLLDYLINLTYVVLRKCS 81

  Fly   249 RIDVKAHPVIRRLVQLKDLIEELKPRYEEYIRPQLEALLERIEDGDAFTVLDVAQRKAKLQILNK 313
            ...::..|.|.||::::.::|:::| .:..:|.|::.|::....|.:         .:...||.|
  Fly    82 GETIEGDPSIERLIEIRTVLEKIRP-IDHKLRYQIDKLVKTATTGVS---------SSTDPILYK 136

  Fly   314 YN-DGQQASVSS---DDDDNDDDDDAESKEKDLQEEAGEEEEEEDARRGITYQMAK--NKGLTPH 372
            .| |...:|...   |:||.:||.|.|.::.|       ||:|::|      ..||  .|..|..
  Fly   137 PNPDDMMSSAGGAGRDEDDGEDDSDEEDEDDD-------EEDEDEA------GAAKMPRKAATAG 188

  Fly   373 RKKELRNPRVK---------HRGKYRKALIRRKGAVRT--------------------------- 401
            :......||:|         ...|.:|||.|.|....|                           
  Fly   189 KSGVYVPPRIKPVYYDGDERDADKEKKALDRAKKRAITSSMLQDLKEEYLDAPTEISSGSRAQQM 253

  Fly   402 ---VRKELQRYGGELSGIKAGVTKSVKFR 427
               .:||.|.| .|...::..|||:.|.|
  Fly   254 LSQAQKEKQEY-EETYLMRLPVTKAEKHR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sas10NP_572215.1 Sas10_Utp3 191..269 CDD:281929 14/77 (18%)
Sas10 354..426 CDD:286457 23/112 (21%)
CG11030NP_001260103.1 Sas10_Utp3 23..103 CDD:397897 14/79 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13237
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.