DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15930 and tej

DIOPT Version :9

Sequence 1:NP_572214.2 Gene:CG15930 / 31446 FlyBaseID:FBgn0029754 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_610950.2 Gene:tej / 36590 FlyBaseID:FBgn0033921 Length:559 Species:Drosophila melanogaster


Alignment Length:435 Identity:90/435 - (20%)
Similarity:173/435 - (39%) Gaps:77/435 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VPLDLRCPSAKMRNNKVL-----ADLSDMLKVVEDIALEEKTTDSKKP-----ANSEQ-QINGTI 85
            ||.:|:.|.:....|::|     ..:..|:...:    ::.|..:::|     |||:. ::|...
  Fly   136 VPRNLKLPVSYPNYNRLLYPVHTPHIDQMISTGQ----QQSTLRTQRPSFPCNANSKSLKVNDWS 196

  Fly    86 ELALDLRQPNAKIRLVISDSSDLQKVFEKAHIALELKTTDSKPTAETDDQHHVRIFDKMLCNIVV 150
            :  .|.:|..:|.|    ::....|:           ||::|...||::.  .:.|:.:..: |.
  Fly   197 Q--KDRKQEPSKER----NNQKYPKI-----------TTENKQEKETEEL--AQAFENLSVD-VA 241

  Fly   151 PPDVADVQVNGKPLEQLLATVSERQAMNNPGPMKMHELHTGNADFMNSNSQVAEAAASVETLLAS 215
            |.|      :.:.|:..:...:|.:.:.:|              |:....:..|..|.|   ||.
  Fly   242 PTD------HQEKLKCEIYEDNEDEFVRDP--------------FIYGEVKEKEDEAVV---LAF 283

  Fly   216 TSDNDSDSDGLESKTTDGYIVKELIP--------SFSDFPDIGDVSLCALMYGL-----PMDAVG 267
            .:.::...|.|...||....||.|.|        |..|..|...:...|:.:.:     |.|||.
  Fly   284 DAVSEDGFDLLSMTTTQQNAVKPLDPPEDCLHYASSDDGEDENAIPAYAVDHRVLDVDYPRDAVR 348

  Fly   268 MHWKLPPQRIQDICKEDSIFPIIMSCVFSPCEFWFHIVPPQYAKNPVAEMTIDLNWFYRHTTISS 332
            ..:.||.:.|:.|.:......:.:..:.:|..|.|.|....: |:..|:.. ::..||..:...:
  Fly   349 SAFTLPARDIESIIELQQRIRVQLVSLVNPHNFNFWIYNDDF-KDYEAQFA-NMQTFYESSESKN 411

  Fly   333 YRAELPSYFYKEGYICAAYSECGWRRAMVL-VTAPLDAQCVNIEYVDHALSVTLAPNHLRFLPLS 396
            |  .:|.:.....::|......||.||.|| ..:..:...:.:|.||....:.::..:::||...
  Fly   412 Y--TMPLFLITTDHLCVVRCTSGWERAKVLGYRSSNNKMTIEVELVDIGDIIRVSQQNVKFLIKP 474

  Fly   397 FARTPPLVFRGKMSHVRPLAN-GWPKNGITAFQRMTFNRVLYAHV 440
            ||..|.....|:::.:....: .|....:..|..|...|:|||.|
  Fly   475 FALLPRQCLAGRLAFITQCKSPNWTAEVVNFFHDMILLRLLYAKV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15930NP_572214.2 TUDOR 281..411 CDD:278965 26/130 (20%)
tejNP_610950.2 LOTUS_TDRD_OSKAR 7..93 CDD:193586
TUDOR 379..488 CDD:278965 25/112 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.