DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15930 and TDRD6

DIOPT Version :9

Sequence 1:NP_572214.2 Gene:CG15930 / 31446 FlyBaseID:FBgn0029754 Length:513 Species:Drosophila melanogaster
Sequence 2:NP_001010870.1 Gene:TDRD6 / 221400 HGNCID:21339 Length:2096 Species:Homo sapiens


Alignment Length:248 Identity:57/248 - (22%)
Similarity:100/248 - (40%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 PMDAVGMHWKLPPQRIQDICKEDSIFPIIMSCVFSPCEFWFHIVPPQYAKNPV--AEMTIDLNWF 324
            |.:.|.....||..|...: |.::.:...:..|.:|.|||..:     .|:.|  :::...:..|
Human   465 PAEEVDEEISLPALRSIRL-KMNAFYDAQVEFVKNPSEFWIRL-----RKHNVTFSKLMRRMCGF 523

  Fly   325 YRHTTISSYRAELPSYFYK---EGYICAAYSECGWRRAMVLVTAPLDAQCVNIEYVDHALSVTLA 386
            |      |..::|.....|   :...|..:.|.|:.||:|   ..||.:.|::..||...|..:.
Human   524 Y------SSASKLDGVVLKPEPDDLCCVKWKENGYYRAIV---TKLDDKSVDVFLVDRGNSENVD 579

  Fly   387 PNHLRFLPLSFARTPPLVFRGKMSHVRPLANGWPKNGITAFQRMTFNRVLYAHVGELDTAQGIFS 451
            ...:|.|...|.:.|.|..:..::.:.||...|.:..::.|::...::.|..|:  ||       
Human   580 WYDVRMLLPQFRQLPILAVKCTLADIWPLGKTWSQEAVSFFKKTVLHKELVIHI--LD------- 635

  Fly   452 MRLSYDETFVPTINDLIESRIKLESCC-------YAPELQPFGMVEPLIMPLH 497
               ..|..:|..|.|  |||...|:..       || :.|.|...|.:::..|
Human   636 ---KQDHQYVIEILD--ESRTGEENISKVIAQAGYA-KYQEFETKENILVNAH 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15930NP_572214.2 TUDOR 281..411 CDD:278965 30/134 (22%)
TDRD6NP_001010870.1 TUDOR <69..133 CDD:278965
TUDOR 246..380 CDD:278965
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..316
TUDOR 314..360 CDD:119391
TUDOR 483..604 CDD:278965 30/135 (22%)
TUDOR 541..585 CDD:119391 12/46 (26%)
TUDOR 770..886 CDD:278965
TUDOR 821..866 CDD:119391
TUDOR 982..1102 CDD:278965
TUDOR 1037..1080 CDD:119391
TUDOR 1301..1422 CDD:278965
TUDOR 1356..1401 CDD:119391
TUDOR 1516..1638 CDD:278965
TUDOR 1571..>1609 CDD:119391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.